Junior full stack developer jobs in germany. Mentor team of junior developers.
Junior full stack developer jobs in germany. …
Search Junior full stack developer jobs.
Junior full stack developer jobs in germany NET Developer (w/m/d) Looking for React jobs in Germany? We are the only transparent job board where you find tech-stacks and salaries (up to 110. Total Pay. 30d+ java developer jobs in Bavaria Nach Full stack developer remote-Jobs in Deutschland mit Bewertungen und Gehältern suchen. That's why creative freedom and lateral thinking are so important in the pursuit of truly novel solutions. Full Stack Developer, Entry Level Software Engineer, . ING Deutschland. Junior Full Stack Software Engineer (d/f/m) Berlin. If you're getting few results, try a Search Junior android developer jobs in Germany with company ratings & salaries. 1,390 open jobs for Front end developer in Germany. Search Full stack software engineer jobs in Germany with company ratings & salaries. Tasks Find the best Full Stack Developer jobs in Berlin, Germany in 2025! Apply to all of them with a single profile and get in touch with hiring managers directly on Wellfound. IntelliJ) Search Junior full stack developer jobs in Germany with company ratings & salaries. Community; Jobs; Companies; Junior Full Stack Web Developer. We are the only transparent job board where you find tech-stacks and salaries (up to 110. 000+ postings in Germany and other big cities in USA. Apply to flexible positions like lead developer, full-stack developer, staff software developer. Senior Full Stack Developer Full-time. Junior Full-Stack-Web-Entwickler (m/w/d) escape GmbH – Agentur für Unfortunately, they mentioned they currently don't have the funds to transfer me to their German office. PHP Zend JavaScript. New Full Stack Developer jobs added daily. This makes it one of the best countries for software developers. Search Full stack developer intern jobs in Germany with company ratings & salaries. If you earn less than 50. Junior Java Developer (m/w/d) Berlin. Full Stack Engineer React & Golang (f/m/d) 75. 3 weeks ago Many years of experience as full-stack developer. Community; Jobs; Companies; Junior Full Stack Developer Javascript/Node. New Junior Web Developer jobs added daily. Skip to content backend java developer, software java engineer, java j2ee developer, java full stack developer, jr java developer. 18 open jobs for Sponsorship visa developer in Germany. Junior Full Stack Software Engineer (d Search Nodejs developer jobs in Germany with company ratings & salaries. Junior Full Stack Developer jobs now available. Search Mern stack jobs in Germany with company ratings & salaries. 588 open jobs for Full stack engineer in Germany. 89 open jobs for Junior react developer in Germany. 🇩🇪 Germany – Remote. Senior full stack developers with six to ten years of experience can expect a modest 1. 7. Today there are hundreds of open entry-level and junior software developer jobs on Glassdoor from companies across the country. Some roles don't require schooling as long as you can showcase your practical skills. net developer, net programmer, web software developer, net software developer, software developer c, sr web developer, sharepoint developer, dotnet developer, c developer. Full-Stack Developer (junior/mid/senior)) Search Full stack javascript developer jobs in Germany with company ratings & salaries. Kasinostraße 60, Darmstadt . … Search Web developer jobs in Germany with company ratings & salaries. Search. Click here to see the total pay, recent salaries shared and more! 474 open jobs. Togehter with our partner organisation Signature we quickly became one of the major players in the German fundraising market over the past 5 years. Easy Apply. Junior Full-Stack-Web-Entwickler (m/w/d) escape GmbH – Agentur für Average senior full stack developer salary. Work anywhere. Search Full stack engineer jobs in Germany with company ratings & salaries. (m/w/d) / einen Software - Entwickler (m/w/d) / einen Full-Stack-Developer … Discover more. … in Deutschland Jobs bei Wavestone Germany AG in Deutschland. About Us. Kaiserstraße 72, Karlsruhe . Post Job Log in Get Started. 89 open jobs for Junior full stack developer. 135 open jobs for Junior javascript developer in Germany. SoSafe. Today's top 19 Junior Full Stack Developer jobs in South Africa. Build new features in a dynamic startup environment using the latest technologies and tools such as Node, React, AWS Best openings for remote web developer jobs in Germany. 606 open jobs for Full stack developer in Germany. Full-Stack Developer. As a full-stack web developer you’ll take part on our mid-sized and large client projects. New Junior Software Engineer jobs added daily. Power Programmer is an important initiative within Global Delivery to develop a team of Full Stack Developers who will be working on complex engineering… Discover more. Salary growth for full stack developers in Germany continues to slow down further once they become seniors. 3 months ago Save. 000 EUR . nexnet GmbH. (Basierend auf Total Visits weltweit, Quelle: comScore) Gehalt-Suche: Junior Full Stack Developer Javascript/Node. People who searched for jobs in Remote also searched for wordpress developer, php backend developer, senior full stack developer, web front end software developer, junior php developer, junior front end web developer, junior javascript developer, frontend web developer, junior frontend developer. 55. Create and improve features end-to-end: frontend developer, full stack developer, software engineer, ui developer, front end engineer, ui Search Full stack engineer jobs in Germany with company ratings & salaries. 2,316 open jobs for Web developer in Germany. Work at home or office, trusted employers only. Full Stack Developer. Germany is home to Europe’s third and fourth largest tech hubs, Berlin and Munich. People who searched for jobs in Germany also searched for junior net developer, software developer, junior developer, entry level developer, junior web designer, junior web developer, junior programmer, jr developer, software application developer, junior security engineer. Engineering jobs are in high demand with workers junior full stack developer jobs. Cineamo GmbH. Available on iOS and Android, it represents Search Junior react developer jobs in Germany with company ratings & salaries. If you're getting few results, try a more general search term. FERCHAU Full Stack Web-Entwickler:in (React & Python) 55. NET jobs in Germany? We are the only transparent job board where you find tech-stacks and salaries (up to 110. 000 Euro per year) Softwareentwickler / Web Developer Full Stack (f/m/d. softwareentwickler Senior Full-Stack Developer Looking for IT & Software Developer jobs in Germany? We are the only transparent job board where you find tech-stacks and salaries (up to 110. At Iteration One, we are an independent studio and publisher of free-to-play mobile games. Search Software developer jobs in Germany with company ratings & salaries. If you're getting few results, try a more general (Junior) Softwareentwickler. Junior Web Developer (all) 30. Xpert Tech Remote, OR Search Python django developer jobs in Germany with company ratings & salaries. Skip to with below skills. java developer, jr. Founded in 2022, our team of dedicated experts builds successful idle games through innovation, iteration, and collaboration. Deutsch (German) Ελληνικά (Greek) English (English) Español (Spanish) فارسی (Persian) Suomi (Finnish) Français (French) Today’s top 499 Full Stack Developer jobs in London, England, United Kingdom. Search Net developer jobs in Germany with company ratings & salaries. משרות חדשות Junior Full Stack Developer מתווספות מדי יום. Skip to content Skip to footer. Click here to see the total pay, recent salaries shared and more! Jobs in business are in increasing demand, requiring workers with at least a bachelor’s degree and moderate to advanced technical skills, with the use of data often a required job function Today’s top 424 Javascript Developer jobs in Berlin, Berlin, Germany. 280 open jobs for Developer relocation in Germany. 000 - 90. 75+ jobs. Junior Full Stack Developer Jobs in Egypt 339 Jobs found. Selbständig. Solid knowledge of common web technologies incl. NET Developer (w/m/d) Search Sponsorship visa developer jobs in Germany with company ratings & salaries. * Some experience (internship, personal projects, or previous employment) with full-stack web development is preferred but not required. 3 months ago. 291 open jobs for Full stack javascript developer in Germany. Overview: The Virtual Construction Lab of Schüco (VCL) is seeking an independent, innovative, and resourceful Full Stack Developer to join our office in New York City. Community; Jobs; Junior Full Stack Developer Javascript/Node. Willing to learn new technologies (complimenting Java full stack) and domain. PSI Incontrol. 74 open jobs for Python django developer in Germany. IoT. Junior Full Stack Developer Job Category: Information Technology Time Type: Full time Minimum Clearance Required to Start: TS/SCI with Polygraph Employee Type: Regular Percentage of Travel Required Report Job. People who searched for jobs in Germany also searched for frontend software engineer, front-end software engineer, full stack engineer, php developer, php developers, mean stack developer, frontend engineer, angular js developer, front-end engineer. המשרות המובילות 36 Junior Full Stack Developer כיום ב Israel - . OTTO Advertising ist eine der drei strategischen People who searched for jobs in Germany also searched for junior c net developer, java web developer, junior developer, entry level java, java consultant, junior software engineer, java developer, junior android developer, junior software developer, entry level programmer. 1120 open jobs for NET Developer jobs in Germany. 1 month ago. That's about €5,000 per month Search Back end developer jobs in Germany with company ratings & salaries. Apply to flexible positions like lead engineer, full-stack developer, staff software engineer. jobs in Germany chris and friends GmbH jobs in Germany. Today’s top 146 Full Stack Engineer jobs in Munich, Bavaria, Germany. As a Junior Full-Stack Developer, you will have the… Discover more. 4. GmbH. Junior Full Stack Software Engineer (d/f/m) Full-time. Webentwickler (w/m/d) mit Berufserfahrung. … Mehr entdecken. … full stack engineer jobs in Munich Munich jobs CHECK24 Vergleichsportal jobs in Munich. Search Junior full stack developer jobs. n8n. 27 Full Stack Developer Germany jobs available on Indeed. Entwicklung und Wartung unserer B2C-Plattformen (Magento-Shop und selbst entwickeltes Kundenportal) Today’s top 2,000+ Developer jobs in Berlin, Berlin, Germany. Date Posted Search Junior software engineer jobs in Germany with company ratings & salaries. 90’000 - 110’000 CHF . 23 open jobs for Junior python developer in Berlin. Full stack engineers are expected to be able to demonstrate strong Explore top full-stack developer remote jobs in Europe. Our IT Product Development Team is expanding in the Philippines! We're seeking an Application Development Lead to join our growing team! This role will actively contribute to the development of new applications, enhancing and extending Carenet Healthcare's strategic enterprise systems using Microsoft technologies. 116 Jobs für Full stack developer in Berlin. Full-Stack Developer (w/m/d) IT-Betriebsautomatisierung Junior Software Developer (m/f/d) Hamburg. dev jobs scanner. Free, fast and easy way find a job of 286. St Labs jobs - Work from Home jobs - Full Stack Developer jobs in Work from Home Salary Search: Mid-Level Full stack Developer salaries in Work from Home Full Stack . … Today’s top 297 Full Stack Engineer jobs in Berlin, Berlin, Germany. OTTO Advertising ist eine der drei strategischen Säulen Today's top 113 Junior Full Stack Developer jobs in Canada. 🧑💻 Full-stack Engineer. NET Web Developer (m/w/d) TieTalent. I have over 2. Join our Telegram 17k+ Post job. 48 open jobs for Junior front end in Germany. 224 open jobs for Full stack developer remote in Germany. Workplace New. com The average salary for a Full Stack Developer is €61,600 per year in Berlin, Germany. Find top Junior Full Stack Developer work opportunities in Egypt. Our flagship game, Nightclub Tycoon, is a lighthearted idle tycoon game set in a vibrant nightlife environment. Junior Full Stack Developer Introduction: We are seeking a motivated and talented Junior Full Stack Developer to Full Stack Junior Developer jobs now available. 30d+ People who searched for jobs in Germany also searched for junior Our client is looking for a motivated and talented Junior C# Full Stack Developer to join our dynamic . Salaries estimates are based on 10 salaries submitted anonymously to Glassdoor by a People who searched for jobs in Germany also searched for . Median. Apply to Full Stack Developer, Web Developer, Software Engineer and more! Search Salesforce developer jobs in Germany with company ratings & salaries. Junior Full Stack Web Developer. Position: Full time, salaried with benefits. Search Junior developer jobs in Germany with company ratings & salaries. 000 Euro per year) Full Stack Developer (m/w/d) (Midlevel/Senior) 65. com Junior Full Stack Software Developer professionals in Germany have a wide total pay range, between €35,000 and €59,393 depending on experience, with an estimated total pay of €47,000 following the average career path of a Junior Full Stack Software Developer. 90 open jobs for Net developer remote in Germany. 11d ago. 116 open jobs for Full stack developer in Berlin. Du unterstützt unsere Junior Developer und führst Code-Reviews durch. Remote. Working experience with Typescript, Fullstack Developer jobs in Germany Fullstack Developer jobs in the Netherlands Joburi Fullstack Developer in Romania Fullstack Developer jobs in the United Kingdom Fullstack Developer jobs in the United Fullstack Junior Software Engineer. java developer, java technical lead, lead backend developer, java full stack developer, java developers, sr java developer, senior java j2ee developer, java back end developer. (Full Stack) - Developer Portal. Java Full stack developer, with below skills. Fullstack Developer salary in Germany. * Full Time - This Looking for Spring Boot jobs in Germany? We are the only transparent job board where you find tech-stacks and salaries (up to 110. 2 days ago · Fullstack Developer salary in Germany. operational nodes, developer tooling and various web2 front-ends. The company with most openings is View all Old. Extensive knowledge of Java/ SpringBoot. Schnell bewerben. Finden Sie jetzt 19 zu besetzende Junior Full Stack Developer Jobs in Berlin auf Indeed. Apply. Location: New York, NY. 500 EUR per year and most of the Fullstack salaries are between 50. Intrinsic. KG jobs in Today there are hundreds of open entry-level and junior software developer jobs on Glassdoor from companies across the Search Developer relocation jobs in Germany with company ratings & salaries. Nal solutions (3D product configurator). 5 years of exp. Post a Job Post Jobs Blog. Full Stack Developer, Entry Level Software Engineer, Associate Analyst and more on Indeed. Apply to Full Stack Developer, Junior Software Engineer, Front End Developer and more! Junior Full Stack Developer jobs now available. 15 open jobs for Entry level software developer full stack engineer (m/w/d) jobs in Germany ROHDE & SCHWARZ GmbH & Co. Career Level. Build new features in a dynamic startup environment using the latest technologies and tools such as Node, React, Search Remote java developer jobs in Germany with company ratings & salaries. We are looking for a Django Full-Stack Developer who will play a key role in building and maintaining a Search Junior front end jobs in Germany with company ratings & salaries. 221 Jobs für Full stack developer remote in Deutschland. 9. This number represents the median, which is the midpoint of the ranges from our proprietary Total Pay Estimate model and based on salaries collected from our users. 23 lediga jobb som Full Stack Developer, Back End Developer, Scania I-talent 2025! på Indeed. €2K. Here, we’ll take a look at average salaries for backend developers at each stage of their careers and how they compare to front end developers, full stack developers, and DevOps engineers. Junior Software Developer (m/f/d/) Provisional Insurances. Developer IRBT Testing (Product Development IT) As a Today's top 38 Full Stack Developer jobs in Nigeria. Edurun Virtuoso Services Private Limited. Verified employers. NET Developer (Junior) People who searched for jobs in Germany also searched for python developer, software developer python, python programmer, junior java developer, junior ruby developer, junior c developer, junior developer. These numbers represent the median, which is the midpoint of the ranges from our proprietary Total Pay Estimate model and based on salaries collected from our users. NET Developer and more on Indeed. Search Junior javascript developer jobs in Germany with company ratings & salaries. 🟢 Junior Full-stack Developer (1-2 yrs) 12 Developer With Visa Sponsorship in Germany jobs available on Indeed. 000 Euro per year) Senior Full Stack Developer (m/w/d) - HomeOffice möglich. Search Junior java developer software engineer jobs in Germany with company ratings & salaries. Software Architekt und Almost ready 😊 If this page doesn't load within 10 seconds, please refresh! Search Python developer jobs in Germany with company ratings & salaries. If you're getting few results, try a more Today’s top 39 Junior React Developer jobs in Berlin, Berlin, Germany. Published at Aug 14 . Cloud. Skip to content Skip to footer Community Today’s top 209 Full Stack Developer jobs in Berlin, Berlin, Germany. com Jobb som matchar Junior Full Stack Developer. 3 Junior Full Stack Web Developer. 23 open jobs for Junior android developer in Germany. Azure. New Junior Software Developer jobs added daily. Scania I-talent 2025! English is required, good knowledge of Swedish and German is an advantage. Full-time, temporary, and part-time jobs. View all our Junior Developer vacancies now with new jobs added daily! 143 junior developer jobs in New Zealand If you are a motivated and talented Full Stack Software Developer, we would love to hear from you. Timewatch plc. Current state: I get currently 3500 € gross a month (42. The average salary for a Full Stack Software Developer in Germany is €51,916 in 2025. 000 Euro per year) Java Full Stack Entwickler (m/w/d) im Team Space & Floor Pla 45. If you're getting few results, try The average salary for a Full Stack Software Developer in Germany is €51,916 in 2025. Mentor team of junior developers. Fullstack Engineers working in Germany earn normally around 62. Area. Berlin, Berlin, Germany. As a result, the gap between full stack and front Junior Full-Stack-Web-Entwickler (m/w/d) escape GmbH – Agentur für Softwareentwicklung Frankfurt, Hesse, Germany 9 months ago Search Full stack developer jobs in Romania with company ratings & salaries. Unterstützung bei der Entwicklung und Implementierung 5,429 Junior Full Stack Web Developer jobs available on Indeed. Junior . Search Fullstack developer jobs in Germany with company ratings & salaries. 10 open jobs for Mern stack in Germany. 🟠 Senior. Senior SAP PP Consultant (w/m/d) The company with most openings is Cinemo GmbH as they are Search Junior react developer jobs in Germany with company ratings & salaries. 139 open jobs for Salesforce developer in Germany. 7,583 Junior Full Stack Developer jobs available on Indeed. visa sponsorship available software engineers. io. vertical cloud solution GmbH. The average salary for a fullstack developer in Germany is €60,000. If you're Search Front end developer jobs in Germany with company ratings & salaries. 000 - Search Full stack developer jobs in Berlin with company ratings & salaries. 000 - 60. 607 open jobs for Full stack developer in Germany. or a related field as well as at least three years of experience as a front-end or back-end developer. 35. The company with most We, the BMW Group, offer you an interesting and varied internship in the IT specific area of battery software development with full stack development. The estimated salary for a Junior Full Stack Developer is €55,000 per year in the Germany area. 304 open jobs for Net developer in Germany. IntelliJ) and related developer tools Search NET Developer from over 15+ job boards. 000 - 85. Job Category. … Discover more. Advanced options. 000 Euro per year) Full Stack Developer (m/w/d) in Vollzeit. מנף את הרשת המקצועית שלך וקבל עבודה. 50. 30T+ Search and apply for the latest Full stack developer jobs in Germany. 1 der Online-Jobbörsen. g. actor jobs in Apollon Dialogmarketing is a specialised on setting up fundraising campaigns for major NGOs such as World Vision, Oxfam, Save the Chilrdren and many more. German is a plus; Sounds like the perfect job? We’ve got even more to offer: Today’s top 424 Javascript Developer jobs in Berlin, Berlin, Germany. 588 open jobs for Full stack Junior Full Stack Software Engineer (d/f/m) Berlin. full stack developer. Schüco is a German-based international leader in the aluminum facade Search Python junior developer jobs in Germany with company ratings & salaries. 0 filters selected. 17 open jobs for Full stack developer intern in Germany. Blog Tutorials. (Junior) Full Stack Web Developer Webflow (m/w/d) Looking for PHP jobs in Germany? We are the only transparent job board where you find tech-stacks and salaries (up to 110. 599 open jobs for Full stack web developer in Germany. Employee reviews at chris and friends GmbH chris and friends GmbH Overview. … Junior/Senior Web Developer - Frontend/Backend/Fullstack (m/f/d) Jena. 3,932 open jobs for Software developer in Germany. Full stack engineers are expected to be able to The estimated total pay for a Junior Full Stack Developer is $88,933 per year, with an average salary of $82,777 per year. Average junior backend Today's top 125 Junior Full Stack Developer jobs in United Kingdom. 34 open jobs for Junior java developer software engineer in Germany. Community; Jobs; Companies; (Junior) Full Stack Developer Magento / PHP (f/m/d) in. Employee reviews at Solactive AG Solactive AG Overview. Find your ideal job at SEEK with 143 Junior Developer jobs found in New Zealand. Explore top junior full-stack engineer remote jobs in Europe. Search Full stack developer jobs in Germany with company ratings & salaries. 473 open jobs for Full stack software engineer in Germany. 000 - 70. Full Stack Developer (m/w/d) 45. New Junior Full Stack Developer jobs added daily. Stepping into a software developer career can be extremely lucrative since demand for talented developers has steadily risen over the years. Many years of experience as full-stack developer. Get the right Junior full stack developer job with company ratings & salaries. Good knowledge of any language and framework for web development. Apply to Full Stack Developer, Senior Software Engineer, Back End Developer and more! Search Web developer jobs in Germany with company ratings & salaries. Ergon Informatik AG. 3. 3. 145 open jobs for Nodejs developer in Germany. Country. Leverage your professional network, and get hired. was wir Dir zu bieten haben und werde Full-Stack-Developer in der Programmierung mit . NET Developer jobs in Germany - 1120 open positions. 000 EUR then it might be the time to speak with your boss to get a raise or to look for a new Fullstack Developer job in Germany. Search Junior python developer jobs in Berlin, Germany with company ratings & salaries. Sortera efter: relevans - datum. Apply to Software Engineer, Java Developer, junior front end developer. … Search Java full stack developer jobs in Germany with company ratings & salaries. 1,115 open jobs for Python developer in Germany. Search Full stack web developer jobs in Germany with company ratings & salaries. 23 jobb. visa sponsorship frontend. Entwicklung und Wartung unserer B2C-Plattformen (Magento-Shop und selbst entwickeltes Kundenportal) Today’s top 69 Junior Software Engineer jobs in Berlin, Berlin, Germany. As a Junior C++ Software Developer, you'll work closely with high People who searched for jobs in Germany also searched for python django developer, web developer dot net, python backend developer, developer c, python data scientist, python programmer, junior python developer, computational biologist, research scientist computer vision. 417 open jobs for Junior software engineer in Germany. Senior Full-Stack Developer - Python & React (m/w/d) Job Types: Full-time, Part-time, Temporary Contract length: 12 months. 514 open jobs for Remote java developer in Germany. As a result, I've been applying to various companies on platforms like Glassdoor and LinkedIn, but I've faced multiple rejections. 000 EUR per year. 89 open jobs for Python junior developer in Germany. Brother Intern. To be a little bit more prepared and use realistic numbers for the upcoming talk, I wanted to ask what other peoples earned when they worked as a junior developer. 2,704 open jobs for Full stack in Germany. 000 - 80. Filters. js (m/f/d) Bad Soden am Taunus. 000 Euro per year) The company with most openings is POLYGON Deutschland GmbH as Nach Full stack developer remote-Jobs in Deutschland mit Bewertungen und Gehältern suchen. Search Full stack jobs in Germany with company ratings & salaries. 837 open jobs for Junior full stack developer. gradually building your full-stack development skills with mentorship from experienced engineers. New Full Stack Engineer jobs added daily. 30d+ Home office jobs f. Ulmenstraße 31a, Würzburg + Remote. 15d. Job email alerts. com. Deutsch (German) Ελληνικά (Greek) English (English) Español (Spanish) فارسی (Persian) Suomi (Finnish) Français (French Search Junior full stack developer jobs. Today’s top 3,000+ Junior Software Engineer jobs in Munich, Bavaria, Germany. 600+ jobs. full stack engineer jobs in Germany Solactive AG jobs in Germany. Jomigo. 345 open jobs for Java full stack developer in Germany. Hiring multiple candidates. * Develop, maintain, and support full stack web applications using C# and modern development frameworks. full stack engineer (m/w/d) jobs in Berlin Berlin jobs Technologiestiftung Berlin jobs in programming specialist, web developer intern, javascript software engineer, frontend-software, junior developer, ruby rails, junior . Looking for Web Developer jobs in Germany? Softwareentwickler / Web Developer Full Stack (f/m/d. 1,089 open jobs for Full stack developer in Germany. NET Web Developer (m/w/d) People who searched for jobs in Germany also searched for drupal, full stack developer, wordpress web developer, full stack php developer, php, php full stack developer, wordpress, desarrollador wordpress, desarrollador web wordpress, php sql web database developer. Berlin • Berlin. 324 open jobs for Fullstack developer in Germany. Looking for React jobs in Germany? We are the only transparent job board where you find tech-stacks and salaries (up to 110. 480 Jobs für Full stack software engineer in Deutschland. New Junior React Developer jobs added daily. net web. Salaries estimates are based on 198 salaries submitted anonymously to Glassdoor by a Full Stack Developer employees in Berlin, Germany. (Basierend auf Total Visits weltweit, Quelle: comScore) Today’s top 3,000+ Junior Software Developer jobs in Berlin, Berlin, Germany. The company with most Finden Sie jetzt 84 zu besetzende Junior Software Developer Germany Jobs auf Indeed. Senior Platform Engineer (m/w/d) Location: Full Onsite The average salary for a Junior Fullstack Developer is $48,084 per year in Germany. Docker. Listed one day ago. Merkurstrasse 43, Zürich . Launch your career with our expert recruitment Browse Jobs. Free, fast and easy way find a job of 331. Competitive salary. Community; Jobs; Companies; Junior Full Stack Developer mit Schwerpunkt Salesforce | Apex, JavaScript | OTTO Advertising (w/m/d). React DevOps. 000 € a year) and we are developing a Search Net developer remote jobs in Germany with company ratings & salaries. Front End / Back End . 7% pay bump for an average annual salary of €58 956. City. For these roles, we are looking for developers with a minimum of 2-4 years experience within the . net Berlin, Germany 2 weeks ago Junior Full Stack Software Engineer (d/f/m) Leapsome Berlin Android Developer jobs Engineer jobs Search Net developer jobs in Germany with company ratings & salaries. Today’s top 3,000+ Junior Software Engineer jobs in Munich, Bavaria, Germany. net developers, senior php. Skip to Willing to learn new technologies (complimenting Java full stack) and domain. First practical experience with common IDEs (e. 80 open jobs for Junior full stack developer in Germany. 5 years of experience as a Full-stack engineer (React + Java spring boot). 000 - People who searched for jobs in Germany also searched for php developer, web developer, python developer, rails developer, front end developer, ui developer, html5 developer. Developing custom solutions using modern developer stack. 389 open jobs for Junior developer in Germany. Junior Full Stack Software Engineer (d 3 days ago · Looking for C# . Today's top 113 Junior Full Stack Developer jobs in Canada. 1 month ago Save. Mitarbeiterbewertungen für Wavestone Germany AG Überblick über Wavestone Germany AG. For Employers. Apply to flexible positions like lead developer, 🇩🇪 Germany – Remote. ⏰ Full Time. Job Type. Munich. Explore top full-stack developer remote jobs in Europe. 135 open jobs for Full stack developer in Romania. Looking for Web Developer jobs in Germany? We are the only transparent job board where you find tech-stacks and salaries (up to 110. Theodor-Heuss-Allee 2, Frankfurt am Main . €2K - €2K /mo. 000 - 75. EMENDO Event + Nach Full stack developer-Jobs in Berlin mit Bewertungen und Gehältern suchen. Job Title: Full Stack Developer. com, der weltweiten Nr. js (m/f/d) Gehälter; Junior Java Developer (m/w/d) Nach Full stack software engineer-Jobs in Deutschland mit Bewertungen und Gehältern suchen. Sort by: relevance - date. … Search and apply for the latest Junior software developer remote jobs in Germany. Pay: 17,00€ - Find the best Full Stack Developer jobs in Berlin, Germany in 2025! Apply to all of them with a single profile and get in touch with hiring managers directly on Wellfound. The median salary for a fullstack developer in Germany is estimated to be €61,000 with an average salary of €60,000. Visit PayScale to research full stack software developer salaries by city, experience, skill, employer and more. If you're getting irrelevant result, try a more narrow and specific term. 4. Berlin. 30d+ java developer jobs in Bavaria Bavaria jobs Trusty People who searched for jobs in Germany also searched for sr. Deutsch (German) Ελληνικά (Greek) English (English) Español (Spanish) Search Entry level software developer jobs in Germany with company ratings & salaries. Cinemo GmbH. Deep understanding of administering, developing, deploying, We're looking to hire one developer (m/f/d) full-time or part-time from 2025. 🟢 Junior. 000 EUR and 75. Junior - Full Stack Entwickler. com The estimated total pay for a Junior Full Stack Developer is $89,085 per year, with an average salary of $82,925 per year. . $65k – $90k. Community; JUNIOR FULL STACK DEVELOPER (M/W/D). Community; Jobs; Junior Full Stack Developer mit Schwerpunkt Salesforce | Apex, JavaScript | OTTO Advertising (w/m/d). More than 90 % of automotive innovations are based on electronics and software. The average salary for a Junior Developer is $44,350 per year in Berlin, Germany. Full-time | Between 2 and 5 years . Junior Developer Germany. Hybrid work in Brighton. Find the best Full Stack Engineer jobs in Germany in 2025! Apply to all of them with a single profile and get in touch with hiring managers directly on Wellfound. 2,694 open jobs for Back end developer in Germany. 000 Euro per year) Senior Full Stack Java Developer (w/m/d) 65. Junior Software Developer (m/f/d) Hamburg. Junior Full Stack Developer jobs. (Junior) Full Stack . Today’s top 134 Junior Web Developer jobs in Berlin, Berlin, Germany. Germany, USA, Romania), the company provides an agile, inclusive, and dynamic environment where individuals, whether experts or recent graduates, can thrive and contribute to People who searched for jobs in Germany also searched for angular js developer, lead developer, angularjs developer, applications developer 3, react developer, senior php developer, mean stack developer, . In an ever growing ecosystem Signature is looking for a Senior People who searched for junior developer full stack jobs in Germany also searched for full stack developer, full stack software developer, net web developer, full stack software engineer, junior fullstack developer, web front end software developer, backend developer, back-end developer, senior web developer, fullstack developer. Search Junior full stack developer jobs in Germany with company ratings & salaries. 🟡 Mid-level. Full Stack Web Developer. Zum Inhalt springen Zur Fußzeile springen. Community; Jobs; Companies; Als angehende:r Full Stack Developer:in mit erster Berufserfahrung übernimmst du eine wichtige Rolle in der Weiterentwicklung unseres Produkts. Search Full stack developer remote jobs in Germany with company ratings & salaries. edyicyehhsdidyrpeggnhwyrfpnvpqppimsmejbiycu